High Purity Salmon Calcitonin Acetate / Salmon Calcitonin CAS 47931-85-1 CAS NO.47931-85-1
- FOB Price: USD: 200.00-800.00 /Kilogram Get Latest Price
- Min.Order: 1 Kilogram
- Payment Terms: L/C,D/A,D/P,T/T,Other
- Available Specifications:
99(1-100)Kilogram99(100-200)Kilogram
- Product Details
Keywords
- High Purity Salmon Calcitonin Acetate
- 47931-85-1
- CAS 47931-85-1
Quick Details
- ProName: High Purity Salmon Calcitonin Acetate ...
- CasNo: 47931-85-1
- Molecular Formula: C145H240N44O48S2
- Appearance: white powder
- Application: CAS 47931-85-1
- DeliveryTime: prompt delivery after payment confirm...
- PackAge: 25kg carton drum(32cm*58cm)or 1kg foi...
- Port: any port in china
- ProductionCapacity: 5000 Kilogram/Month
- Purity: 99%
- Storage: Sealed,light and oxygen resistant
- Transportation: By sea & By air
- LimitNum: 1 Kilogram
- Plant of Origin: Jiangsu China (Mainland)
- Testing Method: uv
- Product Ecification: 99%
- Heavy Metal: eppm
- Voluntary Standards: usp
- name: Salmon Calcitonin Acetate
Superiority
Superiority
pioneerbiotech is a leading manufacturer and supplier of chemicals in China. We develop ,produce and distribute high quality pharmaceuticals, intermediates, special chemicals and other fine chemicals.
We could give you:
1.Best quality in your requirement
2.Competitive price in China market
3.mature Technical support
4.Professional logistic support
All we want is win-win business. Send yr. inquiries, you will get it!
Details
GMP and MDF certificated Salmon Calcitonin,CAS.:47931-85-1, in bulk supply ,welcome inquiry
Name | Salmon Calcitonin 47931-85-1 | ||||
Accession Number | DB00017 (BIOD00025, BTD00025) | ||||
Type | biotech | ||||
Groups | approved | ||||
Description |
Synthetic peptide, 32 residues long formulated as a nasal spray. |
||||
Protein structure | |||||
Protein chemical formula | C145H240N44O48S2 | ||||
Protein average weight | 3431.8530 | ||||
Sequences |
>DB00017 sequence CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTPFASTA |
||||
Synonyms |
|
||||
Salts | Not Available | ||||
Brand mixtures | Not Available | ||||
Categories |
|
||||
CAS number | 47931-85-1 thyrocalcitonin | ||||
Taxonomy | |||||
---|---|---|---|---|---|
Kingdom | Not Available | ||||
Classes | Not Available | ||||
Substructures | Not Available | ||||
Pharmacology | |||||
Indication | For the treatment of post-menopausal osteoporosis | ||||
Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts (bone remodeling cells) and promotes bone formation by osteoblasts. This leads to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. | ||||
Mechanism of action | Calcitonin binds to the calcitonin receptor (found primarily in osteoclasts) which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. | ||||
Absorption | Salmon calcitonin is rapidly absorbed and eliminated. Bioavailability following subcutaneous and intramuscular injection in humans is high and similar for the two routes of administration (71% and 66%, respectively). | ||||
Volume of distribution | Not Available | ||||
Protein binding | 30 to 40% | ||||
Metabolism | Salmon calcitonin is primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. | ||||
Route of elimination | Studies with injectable calcitonin show increases in the excretion of filtered phosphate, calcium, and sodium by decreasing their tubular reabsorption in the kidney. | ||||
Half life | 50-80 minutes | ||||
Clearance | Not Available | ||||
Toxicity | Salmon calcitonin is devoid of embryotoxic, teratogenic and mutagenic potential. | ||||
Affected organisms |
|
About our company
Founded in 2014, as a professional international pharmaceutical corporation,
headquartered in Xi'an (China), KonoChemCo., Ltd. is a leading producer of
standardized herbal extracts, natural active ingredients and APIs for pharmaceutical,
health food and cosmetic industries.
Bulk Herbal Nutrients& Phytochemical Manufacture, Food Ingredients Supplier
The Most Favorable Price Best Quality
Please visit our website: www.konochemical.com
Contact us via Email: sales6@konochemical .com
Telephone: 029- 88771412
Fax: 029- 81330164
QQ: 206474269
5. Package of our products
6.Extraction equipment
7. Express Delivery
To know more about our products, please check the catalogue at below:
PRODUCTS CATALOGUE OF KONO CHEM |
|||||
NO |
NAME |
SOURCE |
PURITY |
STANDARD |
PACKAGE |
001 |
Coenzyme Q10 |
Tobacco |
10%-99% |
USP32 |
Drum & Bag |
002 |
L-Glutathione |
Yeast |
99% |
JP |
Drum & Bag |
003 |
Ecdysterone |
cyanotis arachnoidea |
50%-98% |
CP2005 |
Drum & Bag |
004 |
Capsaicin |
Chili pepper |
10%-95% |
USP32 |
Drum & Bag |
005 006 |
Matrine Oxymatrine |
Sophora flavescens Sophora flavescens |
1%-98% 1%-98% |
USP32 USP32 |
Drum & Bag Drum & Bag |
007 |
Raspberry Ketone |
Raspberry |
99% |
USP32 |
Drum & Bag |
008 |
Oleanolic Acid |
ligustrum lucidum ait. |
98% |
CP2010 |
Drum & Bag |
009 |
Ursolic Acid |
Eriobotrya japonica(Thunb.)Lindl |
1%-98% |
CP2010 |
Drum & Bag |
010 |
Chlorogenic Acid |
Eucommia ulmoides Oliv. |
1%-98% |
CP2010 |
Drum & Bag |
011 |
Usnic Acid |
Usneaceae |
98% |
CP2010 |
Drum & Bag |
012 |
Shikimic Acid |
Illicium verum Hook.f.) |
98% |
USP32 |
Drum & Bag |
013 |
Sinomenine Hcl |
Sinomenium actum Rehd.et |
98% |
USP32 |
Drum & Bag |
014 |
Berberine Hcl |
Coptis chinensis Franch |
98% |
CP2010 |
Drum & Bag |
015 016 |
Silymarin Silybinin |
Milk thistle Milk thistle |
80% 98% |
EP6 EP6 |
Drum & Bag Drum & Bag |
017 018 019 020 021 022 023 |
Lutein Zeaxanthin Lycopene Beta carotene Canthaxanthin Fucoxanthin Astaxanthin |
Marigold flower Marigold flower Tomato Carrot Algae Brown algae Haematococcus pluvialis |
2%-98% 5%-20% 1%-10% 1%-98% 1%-10% 1%-10% 1%-10% |
USP32 IN HOUSE USP32 USP32 USP32 IN HOUSE IN HOUSE |
Drum & Bag Drum & Bag Drum & Bag Drum & Bag Drum & Bag Drum & Bag Drum & Bag |